PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_08081
Common NameKK1_008325
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB_related
Protein Properties Length: 239aa    MW: 27105.1 Da    PI: 7.3205
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_08081genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding445.2e-14121165347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
    C.cajan_08081 121 PWTEEEHRLFLIGLSKFGKGDWRSISRNVVVTRTPTQVASHAQKY 165
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00491365IPR001005SANT/Myb domain
SuperFamilySSF466891.03E-91571IPR009057Homeodomain-like
PROSITE profilePS500906.2261763IPR017877Myb-like domain
CDDcd001672.07E-41759No hitNo description
Gene3DG3DSA:1.10.10.605.5E-43663IPR009057Homeodomain-like
PROSITE profilePS5129420.947114170IPR017930Myb domain
SuperFamilySSF466895.1E-17116171IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-17117169IPR006447Myb domain, plants
SMARTSM007177.3E-11118168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-11118164IPR009057Homeodomain-like
CDDcd001677.04E-10121166No hitNo description
PfamPF002496.5E-12121165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MFPETSATRW PTHPTQWTRF HDKLFERALL AVPEDMPDRW QKIADQVPGK SAAEVRDHYD  60
ALVHDVFEID SGRVEVPSYV DDSPPRAPTA AAGTSSWDSA NQISFGSKPK QGDNERKKGT  120
PWTEEEHRLF LIGLSKFGKG DWRSISRNVV VTRTPTQVAS HAQKYFLRQN SVKKERKRSS  180
IHDITTVDSN SVPVPIDQNW VPPPGTASVQ QPQDMQQYPP SNLHDQMGQF GYSNYGFQM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0830280.0AB083028.1 Glycine max mRNA for syringolide-induced protein 1-3-1B, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237103.11e-147syringolide-induced protein 1-3-1B
TrEMBLA0A151TQ521e-179A0A151TQ52_CAJCA; Myb-like protein J
STRINGGLYMA20G24600.11e-147(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.12e-84MYB family protein